SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010929 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010929
Domain Number 1 Region: 320-661
Classification Level Classification E-value
Superfamily DNase I-like 4.45e-74
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000017
Further Details:      
 
Domain Number 2 Region: 778-794,823-988
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-34
Family BCR-homology GTPase activation domain (BH-domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010929   Gene: ENSMICG00000011984   Transcript: ENSMICT00000012002
Sequence length 990
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3112:304012:399369:-1 gene:ENSMICG00000011984 transcript:ENSMICT00000012002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSVAIQETLAEREYCIXAVQGVLCEGDSRQSRLLGLVRHRPEHGGQEHALFLYMHRRM
AITGDDVSLDQIVPISQDFTLKEVFPDGELYILGSDVTVQLDTAELSLVFQLPFGSHTRT
FLQEVARPCPGLDSTRDPQFLWLSRYGCTDQPESPTPRAWNSAPGTWPGCATIGGGRYPS
RKGQWGLEEAQLLGAGSVLFGGGATEQTDFRLVEVAPGGGPTWGRSARGGRRDEELEEAG
REMSAAGSRERDSAGGSNCDSSRPNGKGLLVDPSSRGQDKPENLLTRQTKSKSEITDMVR
SSTIITVPDKAHILSMQKFGLRDTIVKSHLVQKEEDYTYIQNFRFFVGTYNVNGQSPKEC
LRPWLSHGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKLI
RLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLA
AHTEEFERRNQDYKDICSRMQFCQVDPSLPPLTISRHDVILWLGDLNYRIEELDVEKVKK
LIEEKAFQTLYAYDQLKIQVAAKTVFEGFTEELTFQPTYKYDTGSDDWDTSEKCRAPAWC
DRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVKVINEELYRKTLEEIVRSLDKME
NANIPSVSLSKREFYFQNVKYMQLQVESFKIHNGQVPCQFEFINKPDEESYCKXXXXXXX
XXXXXXXXSDIEIELELFVNKNTATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYLPSC
FGSPIHTLCYMREPILDLPPEVISELTLMPVQTEDDGSRLETPMNIPKELWMMVDYLYRN
AVQQEDLFQQPGLRLEFEHIRDCLDTGMIDNLSASNHSVAEALLLFLESLPEPVICNSAY
HNCLECSGNYTASKQVISTLPTFHKNVFNYLMAFLQELLKNSAKNHLDENILASIFGSLL
LRNPAGDQKLEMTEKKKAQEFIHQFLCNPL
Download sequence
Identical sequences ENSMICP00000010929 ENSMICP00000010929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]