SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010978 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010978
Domain Number 1 Region: 401-425
Classification Level Classification E-value
Superfamily Notch domain 0.0000667
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000010978
Domain Number - Region: 929-1002
Classification Level Classification E-value
Superfamily EF-hand 0.00268
Family Penta-EF-hand proteins 0.09
Further Details:      
 
Domain Number - Region: 465-492
Classification Level Classification E-value
Superfamily Notch domain 0.00863
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010978   Gene: ENSMICG00000012048   Transcript: ENSMICT00000012059
Sequence length 1212
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4341:235005:283089:-1 gene:ENSMICG00000012048 transcript:ENSMICT00000012059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLEWSRDQYHVLFDSYRDNVAGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQ
MEEEQKAMREILGKNTTEPTKKSEKQLECLLTHCIKVPMLILDPALPANITLKDLPSLYP
SFHSASDIFNVAKPKNPSTNVSVVVFDSTKDXXXXXXXXXXXXXXXXXXXXXXTTDKEVP
GLVLMQDLAFLSGFPPTFKETNQLKTKLPENLSSKVKLQYEASVALLKLNPKDFELNKQT
KKNMTIDGKELTISPAYLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVR
NIFIVTNGQIPSWLNLDNPRVTIVTHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWD
GGDCSGNNGGSRFIAGGGGGTGSIGVGQPWHFGGGISGVSYCNQGCANSWLADKFCDQAC
NVLSCGFDAGDCGQDHFHELYKVTLLPNTTHYIIPKGEYLPYFSFAVIAKRGIEGVYSDN
PIIRHASIANKWKTIHLIMHSGMNATIIHFNLTFQNKNDEEFKIQITVEVDTREGPKLNS
TINKAYESLASPITLLPEAEVLFENIPEEKRFPKVKRHDVNTSRFQEEVKIPLVNTSLLP
KEAQLSLNHLDLQLEQGDITLKGYNLSKSALLRSVLMNLQDAKVKINQAVITDEINNNLA
APPEKRVHKSSLPNSLGASERLQRLTFPAVTIKVTDHYQSQNPPLDLENKARFVSESQTP
KVVGRSVSKEKLSPLTVPLENRVTKEKITGKEEEKNRMEENAKNHLSVNKVLLGRKLQHY
TESYLGFLPWEKKKYFQDLLDEEESLKKQLAYFTDSKHTGRQLKDTFADSLRYVNKILNS
KFGFTSRKVPAHMPHMIDRVVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSA
VQPLNISQVFDEVDTDQSGVLSDREIRTLATRIHDLPLSLQDLTGLEHMLINCSKMLPSN
ITQLNNIPATQEAYYDPNLPPVTKSLVTNCKPVTDKIHKTYKDKNKYRFEIMGEEEIAFK
MIRTNVSHVVGQLDDIRKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRAYRDKLKFWTHCVLATLIMFTIFSFFAEQLIALKRKIFPRRR
IHKEASPDRIRV
Download sequence
Identical sequences ENSMICP00000010978 ENSMICP00000010978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]