SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011188 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011188
Domain Number 1 Region: 496-615
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011188   Gene: ENSMICG00000012285   Transcript: ENSMICT00000012288
Sequence length 644
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2758:239139:421658:1 gene:ENSMICG00000012285 transcript:ENSMICT00000012288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKKSVLWSKMHTSHCEDIKQWCRRRLPILEWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAMLSSVHPVFGLYGSLFPAIIYAIFGRGRHVATGTFALTSLISANAVERLVP
QSAQNLSTEGNASVLGLSDFEMQRIGVAAAVSFLAGVIQVAMFVLQLGSVTFLLTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPKGIPPPRAP
RMDILSAVITEAFGVALVGYAASLALAQGSAKKFKYSVDDNQEFLAHGLSNVISSFFFCI
PSAAAMGRTAGLYSTGAKTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXGIWVSTYIFTICFAANVGLLFGVVCTISIVIGRFPXXXXXXX
XXXXXXXXXXXXXXXXETLQQVKIISINNPLVFLNAKKFHMDLMNIIQKENASNQLLDDI
SKEASQSCPNDKCSLVLDCSGLTFFDYSGVSMLVEVYMDCKDRSVDVLLAHCTASLMKAM
QYYGNLDSEKPIFFESVSAAISNIHSNKARCEQLLLDLETMSLR
Download sequence
Identical sequences ENSMICP00000011188 ENSMICP00000011188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]