SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011200 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011200
Domain Number 1 Region: 263-329
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000136
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 208-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 168-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000011200
Domain Number - Region: 134-167
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0013
Family C-type lectin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011200   Gene: ENSMICG00000012303   Transcript: ENSMICT00000012301
Sequence length 384
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1370:311594:330224:-1 gene:ENSMICG00000012303 transcript:ENSMICT00000012301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCRRREGRSKAMMFLWKCQSTQKDLRNIFKLWVWTTLCCXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKSKEDCVEIYIKRNKDAGKWNDDACHKQKAALCYTASCQPWSCSGHG
ECVETINNYTCNCDVGYHGPQCQFVTQCEPLEDPELGNMSCTHPLGDFFFSSRCAFNCWE
GTNLIGIEETTCGPFGNWSSPEPTCEVIQCEPLSAPDLGTMGCSHPLANFSFSSACTFSC
SEGTELIGEKKTICESSGIWSNPSPICQKLDRSFSMIKEGDYNPLFIPVAVMVTAFSGLM
FIIWLARRLRKGKKSQKSVDDPYY
Download sequence
Identical sequences ENSMICP00000011200 ENSMICP00000011200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]