SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011235 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011235
Domain Number 1 Region: 19-200
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.63e-60
Family Brix domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011235   Gene: ENSMICG00000012349   Transcript: ENSMICT00000012339
Sequence length 227
Comment pep:novel scaffold:micMur1:scaffold_5910:29188:29871:1 gene:ENSMICG00000012349 transcript:ENSMICT00000012339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAYDEATDEFASYFNRQTSPKILITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLALKK
IIPQCISRDFTDLIVINEDRKTPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPTEH
IPEVILNNFTTRLGHSIGRMVASLFPHNPQFIGRQVATFHNQRDYIFFRFHRYIFKSEKK
VGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL
Download sequence
Identical sequences ENSMICP00000011235 ENSMICP00000011235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]