SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011269 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011269
Domain Number 1 Region: 533-889
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.78e-71
Family PDEase 0.0000353
Further Details:      
 
Domain Number 2 Region: 381-462
Classification Level Classification E-value
Superfamily GAF domain-like 2.16e-20
Family GAF domain 0.0000076
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000011269
Domain Number - Region: 309-346
Classification Level Classification E-value
Superfamily GAF domain-like 0.0916
Family GAF domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011269   Gene: ENSMICG00000012366   Transcript: ENSMICT00000012376
Sequence length 893
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4204:8495:34851:-1 gene:ENSMICG00000012366 transcript:ENSMICT00000012376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DALLSLGSVIDVAGLQRAVKEALSAVLPRVETVYTYLLDGESRLVCADPPHELPQEGKVR
EAVVSRKRLGCNGLGPSDLPGKPLARLVAPLAPDTQVLFIPLVDKEAGAVAAVILXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXFTDQDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXCSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGH
VATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNESQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHD
GIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXKNLELANYLEDIEIFALFISCMCHDLDHRGTNNSFQ
VASKSVLAALYSSEGSVMEXXXXXXXXXXXXXXXXXXXXXXXXKDYQRMLDLMRDIILAT
DLAHHLRIFKDLQKMAEVGYDRTNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYK
EFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERV
ASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRVPINGCCSLDAE
Download sequence
Identical sequences ENSMICP00000011269 ENSMICP00000011269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]