SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011304 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011304
Domain Number 1 Region: 537-653
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.81e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 2 Region: 207-243,286-422
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-30
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 3 Region: 679-850
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-27
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 4 Region: 988-1093
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-23
Family BCR-homology GTPase activation domain (BH-domain) 0.001
Further Details:      
 
Domain Number 5 Region: 1278-1421
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000142
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 
Domain Number 6 Region: 9-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000044
Family SAM (sterile alpha motif) domain 0.0097
Further Details:      
 
Domain Number 7 Region: 444-538
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000755
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011304   Gene: ENSMICG00000012392   Transcript: ENSMICT00000012414
Sequence length 1440
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4204:111194:151957:-1 gene:ENSMICG00000012392 transcript:ENSMICT00000012414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRV
LAGLLRAHTPPAPAPRPAPRPVPMKRHVFRSPPVPATPPELMPAAGEDEGLPTAPPIPPR
RSCLPPTCFTAPSTAAPEPVLPPLPAKRHLAEPSIPPVPPRTRPPRLLVSLPSKEKLLPP
PLSSPLQPEPEELLSTLPPGPPQPPSPPPCPPEIPPKPQRLFPEFDDSDYYEAPEEGPGP
PASVMTKQEEPPPSRVPRAVRVASLLSEGEELSGDDDLGDEDEDGHAYEGVPNGGWHTSS
LSLPLPSLTSEPLPHPMDGLPGGSTPITPVIKAGWLDKNPPQGSYIYQKRWVRLDADYLR
YFDSNKDAYSKRFISVACISRVAAIGDQKFEVITNNRTFAFRAESDAERRAWMQALQKAV
AEQRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGI
GITFVDMSVGNVKEVDRRSFDLTTPYRIFSFSADSEPEKEQWLEAMQGAIAEALSTSEVA
ERIWTGAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDKKVWT
ETLIELFLQLGNGAGERFWAANVPPSEALQPSSRPGTRRRHLEAKYCEGKYRRFHPLFGN
QEELDKALCAAVTTTDLAETQALLGCGAGISCFSGDPEAPTPLALAEQAGQTLQMEFLRN
NRTTEVPRLDTMKPLEKHYSVVLPTVSHSGFLYKTASAGKPLHDRRAREEFSRRWCVLSD
GVLSYYENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAELA
HEWVKCIAKAFVPPLAEDLLAQDFERLGRLPYKAGLSLQRAQEGWFSLTGSELRVVFPEG
PCEEPLQLRKLQELSVQGDSENQVLVLVERRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLTSEGIYRKCGQTSKTQRLLESLRQDARSVRLK
EGEQNVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEIENEEEKVSRYRELLVRLPPVN
RATVKALISHLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPASMT
AEELTEILDRRNVGVREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKH
QSMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRS
HRPEKEWPVKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELREWFAT
FLFVQHDGLVWPSEPSRVARAVPEVRLGSVSLIPLRGSENEMRRSVAAFTTDPLSLLRNV
Download sequence
Identical sequences ENSMICP00000011304 ENSMICP00000011304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]