SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011307 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011307
Domain Number 1 Region: 516-564
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 2 Region: 596-659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000283
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 90-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 32-80
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000379
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 651-706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000756
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000011307
Domain Number - Region: 468-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011307   Gene: ENSMICG00000012415   Transcript: ENSMICT00000012417
Sequence length 886
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3554:634338:702579:-1 gene:ENSMICG00000012415 transcript:ENSMICT00000012417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIVEDKYYWDNFCDRLCTKQETRECNWQTCPINCLLGDYGPWSDCDPCLEKQTKVRSVLR
PSQFGGQPCTEPLVTSQPCIPSKLCKIEETDCKNKFHCDSGRCIARKLKCNGENDCGDNS
DERGCGSPKPVCSRQYNPIPSVQLMGAGFHFLAGEPRGEVLDNSFTGGICKTVKSSRASN
PYRVPANLENVSFEVQTEEDDLETDFYRDLTSLEQNENQQASSSRGDHNSFRVPIFFSSK
KSQSVNHNSAFKEAIQASHKYDSNFIRIHKVIKVLNFTMKSKDLQLSDVFLKALNHLPLE
YNSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTEEETKTCIRIETKKRV
LFVKKKKVEHRCTTNKLSEKHEGSFLQGAEKAISLVRGGRSEYAAALAWEKGNSGPEEKV
FSEWLESVKENPAVIDFELAPIVDLVRNIPCAVTKRNNLRKAFREYAAKFDPCQCAPCPN
NGRPTLSGTECLCVCRSGTYGENCERRSPDYKSNAIDGNWGCWSSWSMCGATYKRSRTRE
CNNPSPQHGGKPCNGEKRQEEDCTFSIMENNGQPCVSDDEEIKEVDLPEIESDSGCLQPV
PPENGFIRNEKKLYSVGEEVEIACLAGFKTVGYQYFRCLPDRTWRRGDVECQRTECLKPV
VPEVLTLRPYKRLYKIGESIELTCPEGSVVAGPSRYTCGGNSWTPPISNSLTCEKEILTK
LKGHCQPGQKQLESECVCMSPEEDCSHYSEDLCVFDTDFHHYFTSSACKLLAEKCLNNQK
LHFLHTGSCQEGPQLEWGLERIKLSSNSTKKESCDYDTCYDWEKCSVSTSKCVCLLPYQC
FKGGNQLYCVKMGSSMTEKTVNICEVGAVRCANRNVEILHPGKCLA
Download sequence
Identical sequences ENSMICP00000011307 ENSMICP00000011307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]