SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011504 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011504
Domain Number 1 Region: 316-428
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-22
Family BCR-homology GTPase activation domain (BH-domain) 0.0022
Further Details:      
 
Domain Number 2 Region: 70-135
Classification Level Classification E-value
Superfamily PH domain-like 0.00000892
Family Pleckstrin-homology domain (PH domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011504   Gene: ENSMICG00000012608   Transcript: ENSMICT00000012633
Sequence length 1023
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2075:3341:116499:-1 gene:ENSMICG00000012608 transcript:ENSMICT00000012633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMSPQQEAGGGKRGEAAGRSSSLTGVSRIAGGHTKKMKALVERRRSAPSLLLDKALQK
QPTTSVETRYNNNFKIKNKIKLTDMWIASCVDEVGEGNTNTMKSFVLGWPTLNFVATFSS
PEQKDKWLSLLQRYINLEKEKDYPKSIPLKIFAKDIGNCVYSLTVKKLLLTVTVKKSDTA
EVINMLFSVLGVTGSKEDCEQVNSGKAEPYPLVGHAYPYGIKMSHLQNTALLTLRSKDSA
TPFNFQKPFLVEEPPWAMQCLFTVKPSCLAAAQQPRDSHKTSEKRRCLINSACCWASSTD
QDNSLVSLPTSPPVAGQLLGLSLPNICKNDYLPKPIMDILLFLNEKGPLKEGIFFVPANM
EYCQQLKEKLNCGVPVQLYWENAFVLASILMDFLKEIPGSILSSDLYDEWVGIMDNGEDE
DKINKIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILPQDPAEAPS
DTPSHLTDAGDVGKSTRQKRHCSDPSVYYLDPQLSYLREFQKKICKSSRDAVLYQKDEDY
LKQNQPLEVGKTCFKQNLFTSTVTSKKNSTNQNIRKKRLSGNEGKYMKLFHKSKALAISV
SSQDHSKNLFDVDTSGYSPHTGDALKSSRKHWHCSEPNTDDEGKLSLLWGICSKQQHKSR
WESVLLHEEEDYLKWYKCLIEGQKDISQSLVLGIEVGKSSATNQNTRKVLPPGLKLGPRA
SYSSLSSSDTSSTVSSDSAFSQISEDSLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSVTLHPTTGLRNDVASLKNFKKKAKAVKK
IGSLKGPLEPPPNASGVLEDISLEKHNDIPLVVAEGLRAVQSAQWCSSSPCQDSGGRCSS
RFILVESKLKLCMKSHEVEHGGQGSSLPCERASPSSWTVEALASPDGPAVVCDVGNKHLS
KDI
Download sequence
Identical sequences ENSMICP00000011504 ENSMICP00000011504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]