SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011601 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011601
Domain Number 1 Region: 4-368
Classification Level Classification E-value
Superfamily Translation proteins 1.85e-97
Family Ribosomal protein L3 0.00000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011601   Gene: ENSMICG00000012746   Transcript: ENSMICT00000012738
Sequence length 400
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2228:514:8297:-1 gene:ENSMICG00000012746 transcript:ENSMICT00000012738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRKFSAPRHGHLGFLPHKRSRRHRGKVKTWPRDDPSRPVHLTAFLGYKAGMTHTLREV
HRPGLKISKREEVEAVTIVETPPLVVVGVVGYLATPRGLRSFKTIFAEHLSDECRRRFYK
DWHKCKKKAFKACKRDTSGKKQLQKRLMECKVIRXXXXXXMKLLPFRQKKAHIMEIQLNG
GTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKLPRKTHKG
LRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIYRIGRGLHMEDGKMVRNNASTSY
DITDKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQALENIELKF
IDTTSKFGHGRFQTAQEKRVFMGPQKKHLEKEKPESSGDS
Download sequence
Identical sequences ENSMICP00000011601 ENSMICP00000011601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]