SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011645 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011645
Domain Number 1 Region: 4-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-92
Family G proteins 0.00000000325
Further Details:      
 
Domain Number 2 Region: 355-492
Classification Level Classification E-value
Superfamily Translation proteins 1.33e-43
Family Elongation factors 0.00000126
Further Details:      
 
Domain Number 3 Region: 736-849
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.15e-34
Family EF-G/eEF-2 domains III and V 0.0000158
Further Details:      
 
Domain Number 4 Region: 495-565
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.94e-19
Family EF-G/eEF-2 domains III and V 0.0000539
Further Details:      
 
Domain Number 5 Region: 699-735
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000357
Family Translational machinery components 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011645   Gene: ENSMICG00000012772   Transcript: ENSMICT00000012785
Sequence length 852
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3366:4619:14447:-1 gene:ENSMICG00000012772 transcript:ENSMICT00000012785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTXXXXXXXXXXXXXXFISRGKDGSGFLINIDSPGHVDFSSEVTAALRV
DGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIV
ENVNVIISTYGEGESGPMGNIMIDPVLGTVFRSGLHGWAFTLKQFAEMYVAKFAAKGEGQ
LGPAERARKVEDMMKKLWGYFDPANGKFSKSATNADGKKLPRTFCQLILDPIFKVFDAIM
NFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQ
KYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLVSTGL
KVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTI
TTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHI
IAGAGELHLEICLKDLEEDHACIPIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRFDVDVTLHADAIHRGGGQIIPTAR
RCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKA
YLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNTSRPSQVVAETRKRKGLKE
GIPALDNFLDKL
Download sequence
Identical sequences ENSMICP00000011645 ENSMICP00000011645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]