SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011775 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011775
Domain Number 1 Region: 436-468,549-623
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.75e-16
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011775   Gene: ENSMICG00000012921   Transcript: ENSMICT00000012924
Sequence length 678
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_24:619638:662004:1 gene:ENSMICG00000012921 transcript:ENSMICT00000012924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYALLASVPVGYGLYSAFFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDENFL
VPSSNGTALNATMVDSAARDSARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGG
FTTAAAFQVLVSQLKIVLNVSTKNYNGVLSIIYTLIEIFQNIGNTNLADFIAGLLTIVIC
MAVKELNDRFKHKIPIPIPIEVIVTIIATAISYGADLEKNYNAGIVKSIPSGFLPPVLPP
VSLFSEMLAASFSIAVVAYAIAVSVGKVYATKYDYAIDGNQEFIAFGISNIFSGFFSCFV
ATTALSRTAVQESTGGKTQVAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMF
MQVRDVPRLWRQNKIDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSWNGLG
SIPSTDIYKSTKNYKNIEEPEGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRL
KALRKIQKLIKNGQLRATKNGIISDAGTPNNAFEPDEDIEDPEELDIPTKEIEIQVDWNS
ELPVKVNVPKVPIHTLVLDCGAISFLDVVGVRSLRAIVKEFQRIDVNVYFASLQDHVIEK
LEQCGFFDDNIKKDTFFLTVHDAILYLQNQVKSQEGQDSILETITLIQDCKDHLGLMEAE
LIEEELDVQDEAMRKLAS
Download sequence
Identical sequences ENSMICP00000011775 ENSMICP00000011775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]