SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011780 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011780
Domain Number 1 Region: 961-1151
Classification Level Classification E-value
Superfamily Bet v1-like 1.65e-50
Family STAR domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 711-876
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00035
Further Details:      
 
Domain Number 3 Region: 107-152
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.88e-16
Family Variant SAM domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011780   Gene: ENSMICG00000012925   Transcript: ENSMICT00000012929
Sequence length 1164
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2733:120260:369891:1 gene:ENSMICG00000012925 transcript:ENSMICT00000012929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIREDRDKARLDSMVLLIMKLDQLDQDIENALSTSSSPSSTPTNLRRHVPDLESGSQSGA
ETISVNQTQVNVSSNTESTGLPSSTPAANSGTKPKATAIPGISEKEKAEIEAKEACDWLR
ATGFPQYAQLYEDALFDFRLNTLNKCAVMKLEISPHRKRSEDSDEDEPCAISGKWTFQRD
SKRWSRLEEFDVFSPKQDPIPGSPDDSHPKDAASPGAVLMDLSERQEVSSVRSLSSTSSL
PSHASPSEDTATPRTNSVISVCSSGNFAGNDDSFCSLPSPKELSSFSFSMKGHEKNAKSK
TRSLLKRMESLKLKGSHHSKHKAPSKLGLVISGPILHEGVDEDKLKQLNCVEISALNGNR
INVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNKRVGMYLEGFDPFN
QSTFNNVVEQNFKNRETYPEDTVFYIPEDHKPGTFPKALSNGSFSPSGNTSSVNWRTGSF
HGPGHISLRRENSSDSPKELKRRNSSSSVSSRLSIYDNVPGSILYSSSGDLADLENEDIF
PELDDILYHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRATPSD
LDSTGNSLNEPEEPSDIPERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLNSVSLQINCQ
SVAQMNLLQKYSLLKLTALLEKYTPSNKHGFSWAVPKFMKRIKVPDYKDRNVFGVPLTVN
VQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNEGAIDCVNYEGQSA
YDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAVMLLPDDNREVLQT
LLYFLSDVTAAVKENQMTPTNLAVCLEPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDL
NENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALSRLGNAEYTDYQH
FLQDCVDGLYKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSTIEVPAVPEEILK
RLLKEQHLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACA
LLLTSVDHDRAPVVGVRVNVLLSRYLIECGPGKSKLTYICRADLRGHMPEWYTKSFGHLC
AAEIVKIRDSFTNQNTETKDTKSR
Download sequence
Identical sequences ENSMICP00000011780 ENSMICP00000011780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]