SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011852 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011852
Domain Number 1 Region: 240-343
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 473-533
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.52e-19
Family Eukaryotic proteases 0.0039
Further Details:      
 
Domain Number 3 Region: 353-403
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 4 Region: 76-125
Classification Level Classification E-value
Superfamily SRCR-like 0.000000051
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011852   Gene: ENSMICG00000013009   Transcript: ENSMICT00000013005
Sequence length 534
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3132:71331:140047:-1 gene:ENSMICG00000013009 transcript:ENSMICT00000013005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REPDGAGGAWCLPRDGLCGCGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXGKGIAKQTPLSGLGHIPIYWSNVRCRGDEENILLCEKDIWQGVGCPQKMAA
AVSCSFSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
AIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQAPANHFQEST
GPIWLDDVSCSGKDTSFLQCSRKQWGRHDCSHREDVGVACYPGSDGHRLSLGFPIRLMDG
ENKKEGRVEVFIHGQWGTICDDGWSDKDAAVVCRQLGYXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLSSVCGLRLLH
RRQKRIIGGKNSLRGGWPWQVSLRLKSPHGDGRLLCGATLLSSCWVLTAAHCFK
Download sequence
Identical sequences ENSMICP00000011852 ENSMICP00000011852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]