SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011893 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011893
Domain Number 1 Region: 254-374
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.94e-29
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0002
Further Details:      
 
Domain Number 2 Region: 149-277
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.44e-21
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0028
Further Details:      
 
Domain Number 3 Region: 39-100
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000218
Family TGS domain 0.007
Further Details:      
 
Domain Number 4 Region: 530-576
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.000000000298
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011893   Gene: ENSMICG00000013039   Transcript: ENSMICT00000013047
Sequence length 586
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1821:432294:495132:-1 gene:ENSMICG00000013039 transcript:ENSMICT00000013047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKYQPHFIKERLKLFEILKKDHQLLLAIYEKKENASNMITVRVADGKTVQGEVWKTTPYR
VAVEISQELAESTVIAKVNGELWDLDRPLEGDATLELLTFDNEEAQAXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXAVSSTELSALENICKTIIKEKQPFERLEVSKE
VLLEMFKYNKFKCRILNEKVNTPSTTVYXXXXXXXXXXXXXXXXXXXXXXXXIFKNSSTY
WEGNPEMETLQRIYGISFPDNKMMKTWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCF
FLPRGAFIYNTLMEFIREEYHKRNFTEVLSPNVYNSKLWETSGHWQHYSENMFAFEIEKD
TFALKPMNCPGHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLSVYSFSLQLNLSRPELLGESEMWDEAEKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDGDDKKRPVIIH
RAILGSVERMIAILSENYGGKWPFWLSPHQVMVIPVGPTCEEYALQ
Download sequence
Identical sequences ENSMICP00000011893 ENSMICP00000011893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]