SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011973 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011973
Domain Number 1 Region: 147-368
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.45e-88
Family Transglutaminase core 0.00000000465
Further Details:      
 
Domain Number 2 Region: 29-146
Classification Level Classification E-value
Superfamily E set domains 2.52e-32
Family Transglutaminase N-terminal domain 0.0000229
Further Details:      
 
Domain Number 3 Region: 475-588
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.33e-31
Family Transglutaminase, two C-terminal domains 0.00000611
Further Details:      
 
Domain Number 4 Region: 589-689
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-28
Family Transglutaminase, two C-terminal domains 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011973   Gene: ENSMICG00000013134   Transcript: ENSMICT00000013132
Sequence length 690
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4578:24837:55454:-1 gene:ENSMICG00000013134 transcript:ENSMICT00000013132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEXXXXXXXXXXXXXXXXXXXXXXXXXXXLVVRRGQPFRLTLHFEGRGYEPKVDTLSFT
AENGPDPRGDAGTRARFRLKKVADGPGWTASVVDQEEDSCLTLQISTPPNAPVGPYRLNL
EISSGNQGSGFPLGHFILLFNAWCPEDAVHMPSEEERQEYILTQQGFIYQGSSRFINSIP
WNFGQFEDGILDICLALLDINPKCLQNAGQDCSSRTSPIYIARVVSNMVNCNDDQGVLLG
RWDNDYKDGISPTSWLGSVDILQRWKNSGYSPVKYGQCWVFAAVACTVLRCLGVPTRVVT
NYNSAHDQNSNLIIEYYRNEFGEVQGNNNEMIWNYHCWVESWMTRPDLEPGYDGWQALDP
TPQEKSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXITLNYKYPEGSPEEKRVLTRANLMNKLEEKDKEEMGVDMRI
RVNQRMNMGSDFDVFAHIANNTSKTHSCRLRLRARAVSYNGVMGPECATKDLLNLTLKPF
SEEDVPFRILYKNYGDWLTGSNLIKVRGLLVDSNTNSYLLAERDLYLENPEIKIRVLGEP
KQNRKLVAEVSLRNPLTVSLLDCTFTLEGAGLLNSQKMILLSEPVKPGEEIKVRMDLLPL
QVGRRKLVVNFECDKLKAVKGYRNIIIGPR
Download sequence
Identical sequences ENSMICP00000011973 ENSMICP00000011973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]