SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011994 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011994
Domain Number 1 Region: 76-171
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 214-261
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000157
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011994   Gene: ENSMICG00000013166   Transcript: ENSMICT00000013155
Sequence length 262
Comment pep:known_by_projection scaffold:micMur1:scaffold_4918:17331:18354:-1 gene:ENSMICG00000013166 transcript:ENSMICT00000013155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLLTAQPPPRPCPLLAVERIGQRPLWAQSLELPEPVMQPLPAGAFLEEVTEETPAQPE
SEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYL
FTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDS
PDPTPTPALPIPKEEAPGDPALPAPAATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVA
DVDCLPLPRRMADYLRQYPFQL
Download sequence
Identical sequences ENSMICP00000011994 ENSMICP00000011994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]