SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012282 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012282
Domain Number 1 Region: 47-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-28
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 2 Region: 448-486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 163-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 254-275,309-371
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000037
Family Spermadhesin, CUB domain 0.0069
Further Details:      
 
Domain Number 5 Region: 409-447
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 211-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 370-409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012282   Gene: ENSMICG00000013469   Transcript: ENSMICT00000013467
Sequence length 857
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3203:143755:214521:-1 gene:ENSMICG00000013469 transcript:ENSMICT00000013467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRWSTKESPRWRSALLLLFLARVYGNGALAEHSENVHISGVSTACGETPEQIRAPSGI
ITSPGWPSEYPAKINCSWLIRANPGIITISFQDFDIQGSRRCSLDWLTIETYKNIESYRA
CGSTIPPPYISSQDHVWIRFHSDDSISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIPE
AWKCNNMDECGDSSDEEICAKEANPPTAAAFQPCAYNQFQCLSRFTKVYTCLPESLKCDG
NIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNA
ARGFNATYQVDGFCLPWEIPCGGNKCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPCSR
NGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDE
ENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAELLR
REAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSIRLPMAGRSSNI
WNRIFNFARSRHSGSLALVSADGDEVVPSQNTSREPERNHSHRSLFSVESDDTDTENERR
ETAGASGGVAAPLPQKVPPTTAVEATVGACASSSTHSTRGGQTDNGRDVTSVEPPSVSPA
RHQLTSALSRMTQGLRWVRFTLGRSSSVNQNQSPLRQLDNGVNGREEDDDVEMLIPVSDG
ASDFDVNDCSRPLLDLTSDQGQGLRQPYNATNPGVRPSNRDGPCERCGIVHTAQIPDTCL
EATLKNETSDDEALLLC
Download sequence
Identical sequences ENSMICP00000012282 ENSMICP00000012282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]