SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012364 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012364
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.94e-24
Family DEP domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000012364
Domain Number - Region: 304-343
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000569
Family BCR-homology GTPase activation domain (BH-domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012364   Gene: ENSMICG00000013552   Transcript: ENSMICT00000013553
Sequence length 501
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_170:62033:157678:-1 gene:ENSMICG00000013552 transcript:ENSMICT00000013553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHRIVGPGPYRATKLWNETVELFRARMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCS
QNFGPEVTRKQTVQLLKKFLKNHVIEDIKGKWGQEDFEDNRHLYRFPPSSPLKPYPKKPT
YQKDVIKFPEWNDPPLGTSQENIPVKPVVMNSEMWYKRHSIAIGEVPACRLVHRRQLTEA
HVEEIWKSMTLSYLQKILGLDSLEEVLDIKLVNSKFIMHNVYSVSKQGVVILDDKSKELP
HWVLSAMKCLANWPNCSDLKQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LLQKEKMAIEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGFGTRTLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQKS
YPEVYREQFPTPESEALLFEK
Download sequence
Identical sequences ENSMICP00000012364 ENSMICP00000012364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]