SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012366 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012366
Domain Number 1 Region: 534-697
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 24-142
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-24
Family FCH domain 0.0047
Further Details:      
 
Domain Number 3 Region: 729-801
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000174
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012366   Gene: ENSMICG00000013547   Transcript: ENSMICT00000013555
Sequence length 961
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_360:75031:169442:-1 gene:ENSMICG00000013547 transcript:ENSMICT00000013555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQTKFKKDKEIIAEYEAQIKEIRAQLAEQLKCLEQQSESRLQLLQDLQEFFRRRAEIE
LEYSRSLEKLAERFSSKIRGSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
TNNVIVRLSQISEDVIRLFKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYM
SKVKVAKRRANQQETEVFYFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERAEFGTTRP
PCLPPKPQKMRRPRPLSVCGHRLFNGSMEAFIQXXXXXXXXXXXXXXXXXXXXXLQQQGV
FRVPGSQVEVSDIRNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDL
ISAIKLENLAERVHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYCDSPH
SEPGTIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLCHRASED
WWEGRHNGVDGLIPHQYIVVQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXATFGSAGSINYPDRKALSEGHPLRPGGSTRHSSLGDHKSLEAEALA
E
Download sequence
Identical sequences ENSMICP00000012366 ENSMICP00000012366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]