SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012379 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012379
Domain Number 1 Region: 3-17,48-139
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.75e-43
Family Inorganic pyrophosphatase 0.0000187
Further Details:      
 
Domain Number 2 Region: 181-292
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.31e-27
Family Inorganic pyrophosphatase 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012379   Gene: ENSMICG00000013570   Transcript: ENSMICT00000013568
Sequence length 296
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2144:17378:61091:-1 gene:ENSMICG00000013570 transcript:ENSMICT00000013568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVAGHYISPFHDIPLKVDSKEDTEAEGNFIVFSKIWENGIPTKKARNDEYENLFNMVVEV
PRWTNAKMEIATEEPLNPIKQDVKNGKLRYAANIFPHKGYIWNYGALPQTWEDPHQKDKS
TNCCGDNDPIDVCEIGSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XIGDVKKFKPGYLEATLNWFRVYKVPEGKPENQFAFNGEFXXXAFALEVIKSTHECWKAL
LMKKCNGGAINCTNVQVCDSPFHCTQDEARSLVESVSFSLNKESDEEEKAWCFLGK
Download sequence
Identical sequences ENSMICP00000012379 ENSMICP00000012379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]