SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012420 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012420
Domain Number 1 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000128
Family CUE domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012420   Gene: ENSMICG00000013619   Transcript: ENSMICT00000013613
Sequence length 388
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1483:712355:729580:-1 gene:ENSMICG00000013619 transcript:ENSMICT00000013613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFRRSSSGGGGGGSGTAGARGPGAGGGAAAAPQELNNSRPARQVRRLEFNQAMDDFK
TMFPNMDYDIIECVLRANSGAVDATIDQLLQMNLEGGGGSVYEDSSDSEDSIPPEILERT
LEPDSSDEEPPPVYSPPAYHMHMFDRPYPLAPPTPPPRIDALGSGPPPSQRRYRNWNPPL
LGNLPDDFLRILPQQLDSIQGNPGGPKPVSREGGLPATAGPGPRDQESRWKQYLEDERIA
LFLQNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGNDFSFPSPVPXXXXXXXX
XXXXXXXXXXXXXXXXXTRRKLFELARAFSEKTKMRKSKRKHLLKHQSRAAAXXXXXXXX
XXXXXXXEDFRGRRQETPKVEEALREGQ
Download sequence
Identical sequences ENSMICP00000012420 ENSMICP00000012420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]