SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012681 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012681
Domain Number 1 Region: 28-172
Classification Level Classification E-value
Superfamily Sema domain 7.06e-40
Family Sema domain 0.0014
Further Details:      
 
Domain Number 2 Region: 369-479
Classification Level Classification E-value
Superfamily Sema domain 2.35e-26
Family Sema domain 0.015
Further Details:      
 
Domain Number 3 Region: 1949-2101
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.26e-20
Family p120GAP domain-like 0.049
Further Details:      
 
Domain Number 4 Region: 1600-1727
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000863
Family p120GAP domain-like 0.0098
Further Details:      
 
Domain Number 5 Region: 482-533
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000144
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 1248-1292,1322-1375
Classification Level Classification E-value
Superfamily E set domains 0.00000000015
Family Other IPT/TIG domains 0.067
Further Details:      
 
Domain Number 7 Region: 1066-1115
Classification Level Classification E-value
Superfamily E set domains 0.00000000318
Family Other IPT/TIG domains 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000012681
Domain Number - Region: 637-672
Classification Level Classification E-value
Superfamily Plexin repeat 0.00327
Family Plexin repeat 0.0081
Further Details:      
 
Domain Number - Region: 1025-1067
Classification Level Classification E-value
Superfamily Plexin repeat 0.00767
Family Plexin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012681   Gene: ENSMICG00000013880   Transcript: ENSMICT00000013904
Sequence length 2134
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3128:4515:28204:-1 gene:ENSMICG00000013880 transcript:ENSMICT00000013904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALGPALLQALWAGWVLTLQPPPPAAFTPNGTHLQHLARDPTSGTLYLGATNFLFQLSA
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNLNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLGQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXDTLDAYPCGSDHTPSPMASRVPLEATPVLEWPGVQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVA
SCAQHLDCVSCLALRDPYCGWCVLLGRCSRHSECSRGQGPEQWLWSFQPELGCLQVTAMS
PANISREERREVFLSVPDLPPLWPGESYSCHFGEYQSLALLTGSGVMCPSPDPGEAPVLQ
RGADHVSVTVELRFGTVVIAQASLSFYDCVAVTALRPSAQCQACVSSRWGCNWCVWQHLC
THKASCDAGPMVVSQQSPLLSLAPPARDAPTPFPPRAPKVPVTPAPDTLPVAPGAPSIAI
TSDFLPGARPSPLSPWGPWAGPGPRPSPASTESPLHEKPSPPSSPNRPGTTVPAPADFGP
TATSEDLSAAPPSPSDAAAVPPADPGPEAFPSVVPLDQPPGTAPATPFPGATGSTKPALD
WLIREGGELPEADEWTGGDAPTFSTSTLLSGDGDSAEHEGPPAPLILLSSLDYQYDTPGL
WELEVNWGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVGARVECEPPPDTQCHVICQQHQLSYGALQPELHVGLFLRRAGRLRVDSAEGLHVVLYD
CSVGHGDCSRCQTAMPQYGCVWCEEEHPRCVAQEACVKAEAVATQCPAPLIHSVEPLTGP
IDGGTRVTIRGSNLGQHVQDVLDTVRVAGVSCAVDAQEYEVSSXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLPEPQPEQLQCETSPYPVPTMCPVAVWFGGTERRLQHGQFKYTSDPNVTSAGPTK
SFLSGGREIWVRGQNLDVVQMPRIRVTVASGVQQPSRGLGRRRRVVPETACSPGALCVSH
SFEEPCHVNSSQLILCRTPALPGPLKDPWVRVEFILDNLVFNFATLNPTPFSYEADPTLQ
PLNPEDPTVPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPV
EQPLPRHHALREAPDALPEFTVQMGNLCFSLGHVQYDGEGPVAFPVAAQVGLGVGTSLLA
LGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGS
GIPFLDYKVYAERVFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIH
TLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTET
VVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLR
EDVEYRPLTLNALLAMGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSR
TLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHILREN
QDYVPGERTPMLEDVDEGGIRPWHLVKPSEDPEPPRPRRGNLRGGERERAKAIPEIYLTR
LLSMKXXXXXXXXXXXXXXXXXXXXXXXAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSL
PLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARD
IPRYKRMVERYYADIRQTVPASDQEMNSVLAELSRNYSGDLGARVALHELYKYINKYYDQ
IITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences ENSMICP00000012681 ENSMICP00000012681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]