SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012684 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012684
Domain Number 1 Region: 400-485
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.94e-17
Family Tandem AAA-ATPase domain 0.0034
Further Details:      
 
Domain Number 2 Region: 25-132
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.61e-16
Family Tandem AAA-ATPase domain 0.0067
Further Details:      
 
Domain Number 3 Region: 619-644
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000373
Family Ran binding protein zinc finger-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012684   Gene: ENSMICG00000013893   Transcript: ENSMICT00000013908
Sequence length 1045
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2687:518522:640904:-1 gene:ENSMICG00000013893 transcript:ENSMICT00000013908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVENIKKSLTPQISCLTSECYKQLDFLPDKLRAKLLPFQKDGITFALRRDGSRINCDM
GLGKTIQAIAIAYFYKEEWPLLIVVPSSLRYPWTEEIEKWIPELGPEEINVIQNKTDVRR
ISSKVTVLGYGLLTDAETLIDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLFMQIEALFPQKFGSWTDYAKRYCNARIXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLTFTAASHVVFAELYWDPGH
IKQAEDRAHRIGQCSSVNIHYLVANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIHAEEGD
KEKWDLQFAEAWTPNDSSEELRREVLFTHFEKEKQHDIRSFFLPKPKERQLVTSCDESRI
FQEKKTVVASDHRKIVARDTTDYENDFESEAKRLKLVATSDHCSPPEETPSWPRQTIALL
MDGVHEAQSQSTTLAVPREGWQCGFCTYINNSVLPYCEMCENPQGSAVVHIDSLNHIQDK
NKSKKDDSQKNNSTKVQTSSDCEKQVLAQSEPDQLAESKEETSKIEREDRLTPQPGNEQL
KSSDAFPVYDTLMFCASKNTDRIHLYTEDGKQMNCNFIPLDIKLDLWEDLPASFQLKQNR
SLILRFVREWNSLTAMKQRIIRKSGHLFRSPILVLEEIAKQQTKQNCTTRYITKEDVAVA
SMDKVKNTGGHVRLITKESRRWDPATKKFLEDGACVPFLNPDTAQADLTVKPSTSKGYLQ
AVDNEGNPLCLLCQQPTCQTEQACKANAWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEH
GVCQLCNVNAQELFLRVRDAPKSQRKNLLDATWTTKLSLEQLNEMIRNPAEGHFWQVDHI
KPVYRGGGQCSLDNLQTLCTVCHKE
Download sequence
Identical sequences ENSMICP00000012684 ENSMICP00000012684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]