SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012833 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012833
Domain Number 1 Region: 277-470
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.0000402
Further Details:      
 
Domain Number 2 Region: 80-199
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000668
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012833   Gene: ENSMICG00000014083   Transcript: ENSMICT00000014076
Sequence length 475
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_419:18283:577376:1 gene:ENSMICG00000014083 transcript:ENSMICT00000014076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSTNSDTSVETVTSTRQATGAVQMRIKNANSNHDRLSQSKSMILTDVGKVTEPXXXXX
XXXXXXXXXXXXXXXXXXMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSQKIEFYKES
KQQALSNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTVSGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDSYCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHH
SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYSFFERFVEAIKKQDNNTRIETIKSLVQKLPPPNRDTMKVLFKHLTKIVARA
SKNLMSTQSLGIVFGPTLLRAENEAGNMAIHMVYQNQIAELMLSEYSKIFGWEED
Download sequence
Identical sequences ENSMICP00000012833 ENSMICP00000012833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]