SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012843 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012843
Domain Number 1 Region: 133-392
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.03e-53
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000669
Further Details:      
 
Domain Number 2 Region: 406-497
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000000000425
Family Anticodon-binding domain of Class II aaRS 0.011
Further Details:      
 
Domain Number 3 Region: 7-59
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000706
Family a tRNA synthase domain 0.0037
Further Details:      
 
Domain Number 4 Region: 57-100
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0000000414
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012843   Gene: ENSMICG00000014087   Transcript: ENSMICT00000014086
Sequence length 508
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3492:41087:59438:-1 gene:ENSMICG00000014087 transcript:ENSMICT00000014086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERVALEELVRLQGERVRGLKQQKASAEQIEEEVSKLLKLKAQLGPDESKQKFVLKTPK
GTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
QFDPMIPDAECLKIMCEILSSLHIGDFLVKVNDRRILDGMFAICGVPDSKFRTICSSVDK
LDKVSWDEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLR
DLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQTGEEPQGVGSVAAG
GRYDGLVGMFDPGRKVPCVGLSIGVERIFSIVEQRLEASEEKVRTTETQVLVASAQKKLL
EERLKLVSELWDAGIKAELIYKKNPKLLNQLQYCEEAGIPLVAIIGEQXXXXXXXXXXXX
XXXXXVDVRREDLVEEIKRRTSQSLCIC
Download sequence
Identical sequences ENSMICP00000012843 ENSMICP00000012843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]