SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012854 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012854
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 4.52e-41
Family Globins 0.000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012854   Gene: ENSMICG00000014107   Transcript: ENSMICT00000014099
Sequence length 154
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_718:90178:99287:-1 gene:ENSMICG00000014107 transcript:ENSMICT00000014099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADVSGHGQEVLIRLFTGHPETLEKFDKFKHLKTADEMKASE
DLKKHGTTVLTALGAILKKKGQHEAELKPLAQSHATKHKIPVKYLEFISDAIIHVLQSKH
PADFGADAQGAMKKALELFRNDIAAKYKELGFQG
Download sequence
Identical sequences ENSMICP00000012854 XP_012642551.1.48125 ENSMICP00000012854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]