SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012858 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012858
Domain Number 1 Region: 57-394
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.27e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000223
Further Details:      
 
Domain Number 2 Region: 408-503
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.11e-20
Family Anticodon-binding domain of Class II aaRS 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012858   Gene: ENSMICG00000014100   Transcript: ENSMICT00000014103
Sequence length 506
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3492:59774:68964:1 gene:ENSMICG00000014100 transcript:ENSMICT00000014103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLRLLPRRAWAALFSQLLRPPCTSSPGAVHCHSQVAEAVLTSQLKPHQDKPNFVIKTP
KGTRDLSPQQMVVREKILDLVVSCFKRHGAKGLDTPAFELKEVLTEKYGEDSGLIYDLKD
QGGELLSLRYDLTVPFARYLAMNKVKKMKRYHVGKVWRRESPTVLQGRYREFCQCDFDIA
GQFDPMIPDAECLKIMCEILSGLQLGDFLIKVNDRRIMDGMFAVCGVPESKFRAVGSSID
KLDKMSWKDVRHEMVAKKGLAPEVADQIGDYIQCHGGVTLVEQMFQDPRLSQNKQALEGL
EDLKLLFEYLTLFGISEKISFDLSLARGLDYYTGVIYEAILLQSPAQAGEEPLSMGSVAA
GGRYDGLVGMFDPKGHNVPCVGLSIGVERIFSIVEQRMKTLGERIRTSETQVFVATPQKN
FLQERLKLIAELWDAGIKAEMLYKNNPKLLTQLHYCENMGIPLAVIIGEQELKEGVIKLR
SVASREEVAIKRENLVAEIQKRLSES
Download sequence
Identical sequences ENSMICP00000012858 ENSMICP00000012858 XP_012604400.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]