SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013031 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013031
Domain Number 1 Region: 224-426
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.35e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.000000461
Further Details:      
 
Domain Number 2 Region: 10-110
Classification Level Classification E-value
Superfamily SH2 domain 1.17e-18
Family SH2 domain 0.00000589
Further Details:      
 
Domain Number 3 Region: 158-219
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013031   Gene: ENSMICG00000014292   Transcript: ENSMICT00000014294
Sequence length 426
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2120:53753:161503:-1 gene:ENSMICG00000014292 transcript:ENSMICT00000014294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VENRPKYYGREFHGMISREATDQLLSVAEGSYLIRESQRQPGTYTLALXXXXQTRFRLYY
DGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHIGYTTLNREPAYKK
HMPVLKETHDERDPTGQDGVSEKRLTSLVRRATLKENEQIPKYEKVHNFKVHTFRGPHWC
EYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTT
KRPMVVDMCVREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINII
TGALKLYFRDLPIPLITYDAYPKFIESAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVTLHEKENLMNAENLGIVFGPTLMRSPELDAMAALNDIRYQRLVVELLIK
NEDILF
Download sequence
Identical sequences ENSMICP00000013031 ENSMICP00000013031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]