SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013108 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013108
Domain Number 1 Region: 405-565
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013108   Gene: ENSMICG00000014376   Transcript: ENSMICT00000014379
Sequence length 952
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_19:102885:601617:-1 gene:ENSMICG00000014376 transcript:ENSMICT00000014379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSLLHSVFSCSSPASGGPASAKGFSKRKLRQTRSLDPALIGGCGGEAGAEGGARGAT
SGRLYSPLPSAEGLGPRSASSPRGPNPRATRPPPPRPLCSSFSTPSTPQEKSPSGSFHFD
YEVPLGRSGLKKSMAWDLPSVLAGPGSGRSAASILCSTGGGPNGIFTSPRRWLQQRKFQP
PPNCRGQPYVVWKSEGDFTWNSMSGRSVRLRSVPIQSLSELERARLQEVAFYQLQQDCDL
SCQITIPKDGQKRKKSLRKKLDSLGKEKNKDREFIPQAFGMPLSQVIANDRAYKLKQDLQ
RDEQKDASDFVASLLPFGSKRQNKELSSSNSSLSSTSETPNESTSPNTPEPAPRARRRGA
MSVDSITDLDDNQSRLLEALQLSLPAEAQNKKEKARDKKLSLNPIYRQVPRLVDSCCQHL
EKHGLQTVGIFRVGSSKKRVRQLREEFDRGIDVSLEEEHSVHDVAALLKEFLRDMPDPLL
TRELYTAFINTLLLEPEEQLGTLQLLIYLLPPCNCDTLHRLLQFLSIVAMHADDNVSKDG
QEVTGNKMTSLNLATIFGPNLLHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVPPDLQNEVLISLLETDPDVVDYLLRRKASQSSSPDMLQSEVSFSVGGRHSSTDSNKA
SSGDISPYDNNSPVLSERSLLAMQEDAAPGGSEKLYKVPGQYMLVGHLPSSKSRESSPGP
RLGKDMSEEPFNIWGTWHSTLKSGCKDPGMTGSYGDIFESSSLRPGPCSLSQGNLSPNWP
RWQASPTELDSGTQVTGRTQAPAPAAPASRVCSTPPLRVAEPHLTLSSAQDLTESEPDAA
WLQSQAPPPCQRPRGSGRGDKRPPPPYPGPGKPATASPQQPRAGAGRAVDPGSQTAERGP
RRKLSSAHCPAAGEQDGRKLGEAGWLDWQRERWQIWELLSADNPDALPETLV
Download sequence
Identical sequences ENSMICP00000013108 ENSMICP00000013108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]