SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013194 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013194
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.88e-34
Family Chaperone J-domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 243-330
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.88e-23
Family HSP40/DnaJ peptide-binding domain 0.0002
Further Details:      
 
Domain Number 3 Region: 159-241
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.49e-16
Family HSP40/DnaJ peptide-binding domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013194   Gene: ENSMICG00000014487   Transcript: ENSMICT00000014478
Sequence length 337
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3907:378108:388360:1 gene:ENSMICG00000014487 transcript:ENSMICT00000014478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDYYYILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKK
REIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMAGGR
DTEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIFSGCTKRMK
ISRKRLNSDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDH
PKFKRDGSNIIYTAKVSLREALCGCSITVPTMDGRNIPMSINDIVKPGMRRRIIGYGLPF
PKNPEQRGDLLIEFEVSFPDTISSSSKEILRKHLPAS
Download sequence
Identical sequences ENSMICP00000013194 ENSMICP00000013194 XP_012642907.1.48125 XP_012642914.1.48125 XP_012642924.1.48125 XP_012642934.1.48125 XP_012642942.1.48125 XP_012642951.1.48125 XP_012642959.1.48125 XP_020138104.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]