SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013469 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013469
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-17
Family Pleckstrin-homology domain (PH domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 239-300
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000499
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013469   Gene: ENSMICG00000014749   Transcript: ENSMICT00000014769
Sequence length 308
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_523:78811:281823:-1 gene:ENSMICG00000014749 transcript:ENSMICT00000014769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YCWDFQPQGGDLGQDSFDDNHSGTLGLSLTSDARFLSDYQEEGTEDILRGAQELDNIIKQ
GYLEKKSKDHSFFGSEWQKRWCVVSRSLFYYYANEKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEHDLEEDESGTRRK
GVDSANYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNNLIGIVPKEYLT
SAFEVEEK
Download sequence
Identical sequences ENSMICP00000013469 ENSMICP00000013469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]