SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013534 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013534
Domain Number 1 Region: 18-208
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013534   Gene: ENSMICG00000014836   Transcript: ENSMICT00000014844
Sequence length 868
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_154:11387:79152:-1 gene:ENSMICG00000014836 transcript:ENSMICT00000014844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSSSPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGLEQQGL
FQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAISLLRFFLQELPEPVIPGSLHIHLMQ
LSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHENLSANSAVFSDVFHI
YTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSITEQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLERTIR
AAVEQHLFDLQSSIDHDLKNLQQQSLVCNNEAGSINCDGEGSNNQVDIADDIINAIESNR
DCSEPVASTNLDNEVMQQDFLFEDEENNQSLGILLEPCSDHGDSEDGYLERKEYLLFDSD
KLSHLILDSSSKICDLNANTESEVPGDQSVGVQGEAVCVQIPHLDLKNVSDGDKWEXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSYSDIAANP
KVLKWMTELTKLRKQIKAAKHKNSDGEFPQTRPRSNTLPKSFGSSLDHEDEENEDESRIM
QKEKPSKEATLELILKRLKEKRVERCLPEDIKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
VTREERHIVKPLYDRYRLVKQMLTRASITPVLGSPSTKRRGQMLQPIIEGETAHFFEEIK
EEEEDGISLSSELSDILKTAVQGESSLENSESDVEENQEKLALDLRLSSTRAASMPELLE
QLWKARAEKKKLRKTLREFEETFYQQNG
Download sequence
Identical sequences ENSMICP00000013534 ENSMICP00000013534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]