SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013591 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013591
Domain Number 1 Region: 243-369
Classification Level Classification E-value
Superfamily Translation proteins 3.28e-33
Family Elongation factors 0.00000759
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000142
Family G proteins 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013591   Gene: ENSMICG00000014912   Transcript: ENSMICT00000014906
Sequence length 418
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_774:7296:12218:-1 gene:ENSMICG00000014912 transcript:ENSMICT00000014906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXMPWFKGWKVERKEGNASGVSLLEALDTILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGNVCDSSDPPQAAQFTSQVIILNHPGQISAGYSPVIDC
HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPL
Download sequence
Identical sequences ENSMICP00000013591 ENSMICP00000013591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]