SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013611 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013611
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000158
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013611   Gene: ENSMICG00000014930   Transcript: ENSMICT00000014928
Sequence length 205
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4817:76803:82476:1 gene:ENSMICG00000014930 transcript:ENSMICT00000014928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPRCMQCDAKFDFITRKHHCRRCGKCFCDRCCSQKVSLRRMCFVDPVRQCAECALVSHKE
AEFYDKQLKVLLSGATFHATFGNSEKSETVVCRLSNNQRYLFLDGDGHREIEIAHISTVQ
VLTDGFPPGEKDHAYVGLRRSQPASXXGNTRATGMFLQYTVPGEEGVAQLKLTAGEDAHT
SRRQAAAWLAAMHKAAKLLYESRDQ
Download sequence
Identical sequences ENSMICP00000013611 ENSMICP00000013611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]