SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013722 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013722
Domain Number 1 Region: 608-687
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000667
Family BCR-homology GTPase activation domain (BH-domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013722   Gene: ENSMICG00000015026   Transcript: ENSMICT00000015050
Sequence length 988
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1360:615274:675378:-1 gene:ENSMICG00000015026 transcript:ENSMICT00000015050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPFLRAPVKGKKLQKWMYKGRLLSLGMKGRARGTPPKLTGAQSSPNLGALKAENQVLSV
PPDQRITLTDLFENVYGSSMKRRELEDLKDNIEFRGHKPLNSITVSKKRNWLYQSTLRSF
NLEEENKKCQDRSPLSISPVSLPKHQRSQPFFKSSEEYCTYMVCNATNSSLSRNCSLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPGILASTSRTELGVTEPSSPNPSPVKKGSSINWSLPDKIKSPRTVRKLSMKMKRLPEF
SRKLSVKGTLNYINSTDNTPSLSKCNYQEIHHTVILPSGNTTTAARRNVISRYHLDTSVS
SQHSYQKKTSVSSKYSCKGGYLSDGDSPELITKSGKHGSENKFGKGKEVVSNNCSRKKKI
DDVRHSFSDQPQSQYYGRLRVCFYGGEDKKPPQKSLKKVFCALQVASNKKKETAFSPCRT
IFLEVGLFFNIRIEXXVCCHGTVVLPTLFRVTKTHQLAVKLEPRGLIYVKVTLMEQWENS
LHGLDINREPVIFGVDIRRVVEKENIGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAAV
KKELREAFERDSKAVGLCENQYPDINVITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVLLSQRQETTHRVFTDSEEASADFKKHIEVLHYLLQLWPVQRLTVKESTDNLFPEQK
SSVNCLRRKKERPYMLDLSSTDSSGVLRPRQTRLDSPLSNRYAGDWSSCGENYFLNTKEN
LNDVDYDDVPSEDRENGENYSKMDGPEIMIEQPIPTSKECTFQTYLTMQTIESTVDRKVN
LKDLQESIDTLIGNLERELNKNKLNMSI
Download sequence
Identical sequences ENSMICP00000013722 ENSMICP00000013722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]