SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013964 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013964
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.34e-80
Family G proteins 0.0000000224
Further Details:      
 
Domain Number 2 Region: 340-441
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 5.99e-61
Family SCOPe 0.015
Further Details:      
 
Domain Number 3 Region: 238-329
Classification Level Classification E-value
Superfamily Translation proteins 3.96e-59
Family SCOPe 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013964   Gene: ENSMICG00000015319   Transcript: ENSMICT00000015309
Sequence length 462
Comment pep:known_by_projection scaffold:micMur1:scaffold_11830:11462:13589:-1 gene:ENSMICG00000015319 transcript:ENSMICT00000015309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
Download sequence
Identical sequences A0A0D9RNJ1 A0A2I3HHP9 A0A2J8RYS8 A0A2K5N7Z5 A0A2K5RPQ1 A0A2K6KG30 A0A2K6RQ54 A9X189 B1MTF5 B7NZC3 C3PT41 F2Z4P4 F6UME7 F7AW94 F7CXD3 G2HFA2 G3S518 H0V2B3 L8I7U3 P68103 P68104 P68105 Q0PY11 Q4R5K0 Q5R1X2 Q5R4R8 Q66RN5 Q6IPS9 W5PD15
ENSP00000330054 ENSP00000339053 ENSP00000339063 ENSFCAP00000024974 ENSBTAP00000019318 ENSGGOP00000023172 ENSMICP00000013964 ENSCPOP00000003669 ENSPPYP00000018778 ENSPPYP00000018935 ENSETEP00000003473 ENSMMUP00000006451 ENSMMUP00000033423 ENSOCUP00000007327 ENSSSCP00000004843 ENSCAFP00000003867 ENSCAFP00000027428 ENSCAFP00000037784 ENSCAFP00000042956 ENSP00000330054 ENSCJAP00000018523 ENSCJAP00000018841 ENSPANP00000002439 ENSPANP00000016015 ENSBTAP00000019318 ENSVPAP00000007101 ENSSSCP00000004843 ENSPPYP00000018778 ENSPPYP00000018935 ENSPPYP00000023822 ENSCAFP00000003867 ENSCAFP00000027428 ENSCAFP00000037784 ENSCAFP00000042956 ENSPTRP00000045593 NP_001009165.1.37143 NP_001009326.1.62641 NP_001075808.1.1745 NP_001090887.1.46622 NP_001182679.1.72884 NP_001184045.1.84170 NP_001271523.1.63531 NP_001393.1.87134 NP_001393.1.92137 NP_776960.1.59421 NP_776960.1.76553 XP_003271170.1.23891 XP_003477948.1.53824 XP_003809576.1.60992 XP_004008202.1.66739 XP_004009908.1.66739 XP_004020260.1.66739 XP_004044340.1.27298 XP_004422093.1.5094 XP_004476030.1.11602 XP_004673686.1.23501 XP_004864007.1.39548 XP_005405386.2.28644 XP_005617616.1.84170 XP_005618552.1.84170 XP_005654459.1.46622 XP_005684485.1.57651 XP_005902410.1.15283 XP_006071161.1.26621 XP_006204402.1.17985 XP_006728724.1.47382 XP_006728725.1.47382 XP_006931902.1.62641 XP_007090174.1.5354 XP_007116560.1.24612 XP_008011674.1.81039 XP_008011675.1.81039 XP_008992919.1.60252 XP_008992920.1.60252 XP_009000156.1.60252 XP_009240283.1.23681 XP_009240413.1.23681 XP_009449809.1.37143 XP_010355019.1.97406 XP_010358768.1.97406 XP_010369129.1.97406 XP_010370521.1.97406 XP_010378150.1.97406 XP_010639415.1.5607 XP_010948070.1.22495 XP_011533816.1.92137 XP_011922825.1.92194 XP_011922826.1.92194 XP_012037775.1.66739 XP_012634492.2.48125 XP_012915112.1.14098 XP_014992221.1.72884 XP_015304294.1.63531 XP_016061229.1.3490 XP_017379832.1.71028 XP_017726824.1.44346 XP_017726825.1.44346 XP_017741409.1.44346 XP_019273292.1.44245 XP_019295827.1.44245 XP_019685628.1.62641 XP_019822593.1.53367 XP_020765380.1.74333 XP_021548759.1.83697 ENSMMUP00000006450 ENSCJAP00000018523 ENSVPAP00000007101 10141.ENSCPOP00000003669 9544.ENSMMUP00000006451 9598.ENSPTRP00000045593 9600.ENSPPYP00000018778 9600.ENSPPYP00000018935 9606.ENSP00000330054 9615.ENSCAFP00000003867 9615.ENSCAFP00000027428 9796.ENSECAP00000018148 9913.ENSBTAP00000019318 9986.ENSOCUP00000007327 ENSGGOP00000023172 5lzs_jj ENSCPOP00000003669 ENSETEP00000003473 ENSMICP00000013964 ENSOCUP00000007327 gi|4503471|ref|NP_001393.1| ENSPTRP00000045593 ENSECAP00000018148 ENSP00000330054 ENSP00000339053 ENSP00000339063 ENSOARP00000006586 ENSOARP00000008327 ENSOARP00000012452 ENSNLEP00000005151 ENSECAP00000018148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]