SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013997 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013997
Domain Number 1 Region: 34-266
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.25e-20
Family FAD-linked reductases, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013997   Gene: ENSMICG00000015361   Transcript: ENSMICT00000015353
Sequence length 286
Comment pep:novel genescaffold:micMur1:GeneScaffold_1317:7063:48602:1 gene:ENSMICG00000015361 transcript:ENSMICT00000015353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTVSELVSPLVGLWLLLCSWGCPGSAEPRSPPEKIAIIGAGIGGTSAAYILRQKFGKD
VKIDVFEREEVGGRLATLTVQGEDYEAGGSIIHPLNLHMKRFVKDLGLSAIPLPSGLVGV
YDGETLVFEQSSWFIINMIKLIWHYGFQSFRMRMWVDDVLGKFMRIYRYQSHEYAFSSVE
KLLHAAGGDEFLGLLNRTLLEALQKAGFSEKFLNEMVAPIMRINFGQSTGLNAIVGAMSL
SSSDSGHWAVEGGNKLVCSGLLQASKSNLISGSVMYIEEKTRTKQT
Download sequence
Identical sequences ENSMICP00000013997 ENSMICP00000013997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]