SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014235 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014235
Domain Number 1 Region: 360-536
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 279-336
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000802
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000014235
Domain Number - Region: 29-104
Classification Level Classification E-value
Superfamily Tropomyosin 0.0641
Family Tropomyosin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014235   Gene: ENSMICG00000015618   Transcript: ENSMICT00000015622
Sequence length 628
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1972:121084:141524:-1 gene:ENSMICG00000015618 transcript:ENSMICT00000015622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTTMLNLRNLFEQLVRRVEILSEGNELQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEE
QKSALAFLNRGQPSSGNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKR
KRRSNSRQFVDGPPGPVKKTRSIGSTVDQGNESIVAKTTVTVPNDGGPIEAVSTIETVPY
WTRSRRKTGTLQPWNSDSTLSSRQLEPRTETDNAGTPQNNGGMRLHDFVSKTVIKPESCV
PCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGMLTDFVSQTPMI
PSIVHCVNEEQRGLTETGLYRISGCDRTVKELKEKFLRVKNVPLLSKVDDIHAICSLLKD
FLRNLKEPLLTFRLNKAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVA
LSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMM
VEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTK
NTPRFGSKSKSATNLGRQGNFFASPMLK
Download sequence
Identical sequences ENSMICP00000014235 ENSMICP00000014235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]