SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014263 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014263
Domain Number 1 Region: 26-253
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-45
Family Nuclear receptor ligand-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014263   Gene: ENSMICG00000015667   Transcript: ENSMICT00000015654
Sequence length 256
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1385:226604:228486:-1 gene:ENSMICG00000015667 transcript:ENSMICT00000015654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSQPGPCPCRGAVGRPAILYELLSPSLRPVPLPRSHCLCRQHRPVRLCTPHRTCREAL
DVLAKTVAFLRNLPSFCQLPPQDQRRLLQGGWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGSSGQPDRPQPSLAEVQWLQCCLESFWSLELGPKEYAYLKGTILFNPDVPG
LHTSSHIGHLQQEAHWALCEVLEPWSSAGQGRLARVLLTASTLKSIPPSLLGDLFFRPII
GEVDIAGLLEHMLLLR
Download sequence
Identical sequences ENSMICP00000014263 ENSMICP00000014263 XP_012606113.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]