SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014321 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014321
Domain Number 1 Region: 401-602
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-45
Family DBL homology domain (DH-domain) 0.00052
Further Details:      
 
Domain Number 2 Region: 616-685,743-778
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-16
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 3 Region: 1064-1121
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000491
Family BCR-homology GTPase activation domain (BH-domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 820-944
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000577
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 
Domain Number 5 Region: 960-1020
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000000353
Family BCR-homology GTPase activation domain (BH-domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014321   Gene: ENSMICG00000015708   Transcript: ENSMICT00000015719
Sequence length 1121
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_707:148012:265317:1 gene:ENSMICG00000015708 transcript:ENSMICT00000015719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVSNSTTRPADSAPPHAEEAEAWPDGDGSLGKARPAAACRPGAAAPAERDDRGPPGSVA
ALRSNFERVRKGQAQPGAADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGTQAMQME
RRKAQQGAAPGPGDAPRPAYRGRASESSCGLDGDYEDAELNPRFLKDNLVHANGGGRPPW
PPLEYQPYQSIYVGGMMGEAEGKGPLLRSQSTSEQEKRLTWXXXXXXXXXXXXXXXXXXX
XXXXXXXXXFREEGFSSGQSSRGSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHK
RHRHCQVVVSEATIVGVRKTGQIWPSDGEGTFHGDADVSIGTPPGYGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSELDLEKGLEMRKWVLSGILASE
ETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQ
WSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMETAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDHSLLQDALRISQNFLSSINE
EITPRRQSMTVKKGEHRQLLKDSFMVELVEATRKLRHVFLFTDLLLCTKLKKQIGGKTQQ
YDCKWYIPLTDLSFQTVDESEAAPNIPLVPDEELDALKIKISQIKSDIQREKRANKGSKA
AERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERAEWRESIREQQKKCFK
SFSLTSVELQMLTNSCVKLQTVHNIPLTINKEDDESPGLHGFLNVIVHSATGFKQSSNLY
CTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKISKED
GESTDRLMGKGQVQLDPQVLQDRDWQRTVIAMNGXXXKLSVKFTSREFSLKRMPSRKQTG
VFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSDPVAKESCMLNLLLS
LPEANLVTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTL
Download sequence
Identical sequences ENSMICP00000014321 ENSMICP00000014321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]