SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014354 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014354
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.52e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014354   Gene: ENSMICG00000015763   Transcript: ENSMICT00000015755
Sequence length 209
Comment pep:novel scaffold:micMur1:scaffold_7282:12112:17629:1 gene:ENSMICG00000015763 transcript:ENSMICT00000015755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKRIAVIGAGVSGLGAIKSCLEEGLEPTCFERSNDIGGLWRYEEMTESGRSSIYKSAT
TNTSKEMTSYSDFPFPDHLPNYLHNSKIMEYVQMYAKHFHLMKHIRFLSKVCSVKKRSDF
SCTGQWDVVVEAEGKQESHVFDGVMVCSGLYTHPSLPLQDFPGIKKFQGQYIHSWEYKSP
EKFRDKKIMVVGIGNSGVDLAIELSHVTA
Download sequence
Identical sequences ENSMICP00000014354 ENSMICP00000014354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]