SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014395 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014395
Domain Number 1 Region: 223-537
Classification Level Classification E-value
Superfamily DNase I-like 5.76e-74
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000256
Further Details:      
 
Domain Number 2 Region: 681-696,734-895
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014395   Gene: ENSMICG00000015790   Transcript: ENSMICT00000015797
Sequence length 904
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_808:173692:221184:1 gene:ENSMICG00000015790 transcript:ENSMICT00000015797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPLPVGAQPLARPHTIEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIP
INSHFRCVQEAEETLLIDIASNSGCKIRVQGDWTRERRFEIPDEEHCLKFLSEVLAAQEA
QSQLLVPEQKDSSSWYQKLDTKDNPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREP
PPPPSSVNRMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNI
QTFRFFVGTWNVNGQSPDSGLEPWLNCDSNPPDLYCIGFQELDLSTEAFFYFESMKEQEW
SMAVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQYRYIRDIATETVGTGVMGKMGNKGG
VAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHDVV
IWLGDLNYRLCMPDASEVKSLINKNDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTY
KYDSKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVFENVKFRQLQKEKFQISNNGQVPC
HFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDIL
VLHLDRGKDYFLTISGNYLPSCFGTSLEALXXXXXXXXXXXXXXXXXXXXXCLLTRGKSL
LQMVPLDEGASERPLQVPKEIWLLVDHLFKHACKQEDLFQTPGMQEELQQIIDCLDTSIP
ETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAHDPRICRQVISQLPRCHRNVFR
YLMAFLRELLKFSEYNNISANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLG
SDED
Download sequence
Identical sequences ENSMICP00000014395 ENSMICP00000014395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]