SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014426 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014426
Domain Number 1 Region: 4-374
Classification Level Classification E-value
Superfamily Translation proteins 1.15e-108
Family Ribosomal protein L3 0.00000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014426   Gene: ENSMICG00000015832   Transcript: ENSMICT00000015830
Sequence length 402
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_720:35611:42098:-1 gene:ENSMICG00000015832 transcript:ENSMICT00000015830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV
DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTIFAEHISDECKRRFYK
NWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRIIAHTQMRLLPLRQKKAHL
MEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIVTKGKGYKGVTSRWHTKKLP
RKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKN
NASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALE
KIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA
Download sequence
Identical sequences ENSMICP00000014426 ENSMICP00000014426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]