SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014523 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014523
Domain Number 1 Region: 70-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000593
Family Selenoprotein W-related 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000014523
Domain Number - Region: 28-72
Classification Level Classification E-value
Superfamily SRCR-like 0.0523
Family Scavenger receptor cysteine-rich (SRCR) domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014523   Gene: ENSMICG00000015940   Transcript: ENSMICT00000015933
Sequence length 102
Comment pep:novel genescaffold:micMur1:GeneScaffold_2995:1545414:1573897:-1 gene:ENSMICG00000015940 transcript:ENSMICT00000015933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGPGRWLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNL
LQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQ
Download sequence
Identical sequences ENSMICP00000014523 ENSMICP00000014523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]