SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014536 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014536
Domain Number 1 Region: 323-670
Classification Level Classification E-value
Superfamily SIS domain 1.11e-94
Family double-SIS domain 0.00000136
Further Details:      
 
Domain Number 2 Region: 2-209,250-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.78e-54
Family Class II glutamine amidotransferases 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014536   Gene: ENSMICG00000015921   Transcript: ENSMICT00000015946
Sequence length 670
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_220:62241:97815:-1 gene:ENSMICG00000015921 transcript:ENSMICT00000015946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEAKERQIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGIPNAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYRTCTIENVKNICQARVK
RLDSSTCLHAVGDKAVEFFFASDASAVIEHTNRVIFLEDDDIAAVAEGKLSIHRIKRSAS
DDPSRAIQTLQMELQQIMKGRCNFSAFMQKEIFEQPESVFNTMRGRVNFESNTVLLGGLK
DHLKEIRRCRRLIVIGCGTSYHAAVATRQMLEELTELPVMVELASDFLDRNTPVFRDDVC
FFISQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKA
YTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLDEQIHDLALELYTQ
RSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDP
CFAKCQNALQQVTARQGRPIILCSQDDTESPKSAYRAIPLPRTVDCLQGVLSVIPLQLLS
FHLAALRGCD
Download sequence
Identical sequences ENSMICP00000014536 ENSMICP00000014536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]