SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014553 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014553
Domain Number 1 Region: 611-651,685-909
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-44
Family G proteins 0.0000611
Further Details:      
 
Domain Number 2 Region: 1077-1207
Classification Level Classification E-value
Superfamily Translation proteins 1.23e-33
Family Elongation factors 0.0013
Further Details:      
 
Domain Number 3 Region: 953-1073
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 1.57e-32
Family Initiation factor IF2/eIF5b, domain 3 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014553   Gene: ENSMICG00000015960   Transcript: ENSMICT00000015964
Sequence length 1209
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1295:79351:133848:1 gene:ENSMICG00000015960 transcript:ENSMICT00000015964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILKELEELSLEAQGI
KADRETTGVKPTENNEEEFTSKQDKKKKGQKGKKQSFDDNDSEELEEKDSKSKKTAKPKG
EVYSGSDDDDDFNKLSKKAKGKAQKSNKKWDGSEEDEGNSKKIKERSRVNSSGESGDESD
EFLQSRKGQKKNQKNKQGPDVESGNEDDDSSFKIKTVAQKKAEKKERERKKRDEEKAKLR
KLKEKEELETGKKDQSKQKDSQKKSEEEAVKSKVTFDTGVTSASEEKGEIPTAAEDDNEG
DKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKREEEERIKRLEE
LEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAEATLKLLQAQGV
EVPSKDSLPKKRPIYEDKKKKKIPQQLENKEVSEPVELSATVEVVEQGVPEKEETPPPVE
PGHKEETEDAGLDDWEAMASDEEREKVEGNTVHIEVKENPEEEEEEEEEEEEEEESEEEE
EEEGESEGSEDDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRTKEERAYDKAKR
RIEKRRLEHSKNVNTEKLRAPVICVLGHVDTGKTKILDKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMH
GLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERA
KAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTMLSKRLA
HCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPMK
ELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTL
NAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVMLEHDPQY
AVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFP
CKMKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTSIEINHKQVDVA
KKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIV
ELKKVFEII
Download sequence
Identical sequences ENSMICP00000014553 ENSMICP00000014553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]