SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014593 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014593
Domain Number 1 Region: 478-608
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.03e-54
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000198
Further Details:      
 
Domain Number 2 Region: 230-319,353-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014593   Gene: ENSMICG00000016006   Transcript: ENSMICT00000016008
Sequence length 613
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_552:200103:234915:-1 gene:ENSMICG00000016006 transcript:ENSMICT00000016008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVYKTIKDDKKRYNERISELGLTPEEKQKRAASSXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREV
KSITIIGGGFLGSELACALGRKAQALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPDAIVQSVGVSGGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
IAIPASTPAIPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
Download sequence
Identical sequences ENSMICP00000014593 ENSMICP00000014593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]