SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014691 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014691
Domain Number 1 Region: 41-137
Classification Level Classification E-value
Superfamily SH2 domain 6.36e-29
Family SH2 domain 0.00000417
Further Details:      
 
Domain Number 2 Region: 264-325
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-22
Family SH3-domain 0.0000346
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000106
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014691   Gene: ENSMICG00000016121   Transcript: ENSMICT00000016118
Sequence length 326
Comment pep:known_by_projection scaffold:micMur1:scaffold_1399:228380:247541:1 gene:ENSMICG00000016121 transcript:ENSMICT00000016118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPEWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTTSISKQKQIFLRDRTREDQGRRGNSLDRRPQGGPHLSGAVGEEMRP
SMNRKLSDHPPALPPQHQQPQQAPLQCTLALQPPQQRYLQHPHFHQERRGGSLDINDGHC
GTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSS
NPSWWTGRLHNKLGLFPANYVAPMTR
Download sequence
Identical sequences ENSMICP00000014691 ENSMICP00000014691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]