SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014692 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014692
Domain Number 1 Region: 340-657
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-91
Family p120GAP domain-like 0.0000271
Further Details:      
 
Domain Number 2 Region: 214-335
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000058
Family PLC-like (P variant) 0.085
Further Details:      
 
Domain Number 3 Region: 162-211
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000143
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014692   Gene: ENSMICG00000016118   Transcript: ENSMICT00000016119
Sequence length 1158
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4610:224437:352002:1 gene:ENSMICG00000016118 transcript:ENSMICT00000016119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGSARKSTGRSSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSE
KSPSMEPSAATPFRVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSK
CFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDV
LYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAAS
VAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLC
AALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATK
AIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMCCELAFC
KIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQ
EYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPET
ISNTAGFEGYIDLGRELSSLHSLLWEAISQLEQSIVSKLGPLPRILRDVHTALSTPGSGQ
LTGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQ
PSPARSSSYSEANEPDLQMANGGKSLSMVDLQDTRTLDGEAGSPAGPDILPTDGQAPATQ
LVAGWPARAAPVSLAGLATVRRAGQTPTTPGTSEGTPGRPQLAPLSFQNPVYQMAAGLPL
SRGLGDSGSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXGPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPD
PPPRDRLRSKEELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLE
EGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLD
AANARLMSALTQLKESMH
Download sequence
Identical sequences ENSMICP00000014692 ENSMICP00000014692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]